Free Shipping Over $150+
PNC-27 (10mg)
$209.99
PNC-27 is a p53-HDM-2 binding domain peptide studied in cancer-cell membrane and apoptosis research models. Lyophilized powder for laboratory research use only.
We Accept:
Certificate of Analysis
DOWNLOAD
Independently Verified. Every Batch
Every Aurevena product is sent to an independent, accredited third-party laboratory before it is offered for sale. Certificates of Analysis confirm compound identity, purity percentage, and the absence of harmful contaminants.
COAs are published by lot number so researchers can verify the exact product they receive. We do not sell any product that does not clear our purity threshold.
- Compound identity (HPLC / MS verification)
- Purity percentage (target ≥ 99%)
- Absence of heavy metals
- Lot-number traceability
CERTIFICATE OF ANALYSIS
PNC-27 (10mg)
10mg
PURITY
99.90%%
ASSAY
9.92mg
IDENTITY
Confirmed
HEAVY METALS
<10 ppb
TAMC
0 CFU
TYMC
0 CFU
- Description
- Compound Info
- Research Overview
Description
PNC-27 is a synthetic peptide containing the p53 HDM-2-binding domain fused to a membrane-residency (penetratin-like) sequence, used as a tool compound in cancer-cell research. Laboratory investigators study PNC-27 for its modeled selective interaction with HDM-2 expressed in the membranes of transformed cells, where it is examined for membrane-pore formation and necrosis/apoptosis-related mechanisms in vitro and in preclinical systems. Supplied for in-vitro and laboratory research only — not for human or veterinary use.
| Compound Class | Synthetic 32-amino acid peptide (p53 MDM2-binding domain fused to a membrane-residence peptide) |
|---|---|
| CAS Number | Not assigned |
| Molecular Formula | Variable; full sequence-dependent |
| Molecular Weight | Approximately 3.7 kDa |
| Sequence | PPLSQETFSDLWKLLPENNVLKKLAAAKAGAATAGKKAAATAKAAATGEAQ (approximate; full sequence in scientific literature) |
| Appearance | White to off-white lyophilized powder |
Research Overview
Used in in vitro and preclinical research relating to p53/MDM2 protein-protein interaction chemistry and membrane-interacting peptide studies.
Storage
Store unreconstituted vials refrigerated at 2-8°C and long-term at -20°C; once reconstituted, store at 2-8°C and use within 30 days.
IMPORTANT RESEARCH NOTICE
Not for human consumption.
This product is sold exclusively for research and educational purposes. It is not intended to diagnose, treat, cure, or prevent any disease. All clinical trial data and research findings presented on this page are sourced from peer-reviewed journals and official publications. They are provided for educational reference only and should not be interpreted as medical advice or product claims. By purchasing this product, you confirm that you are a qualified researcher and will use it in accordance with all applicable laws and regulations.
Frequently Asked Questions
How should I store my peptides?
Lyophilized (powder) peptides should be stored at -20°C for long-term storage or 2-8°C (refrigerator) for short-term. Always protect from light and avoid repeated freeze-thaw cycles.
What is your return policy?
We offer damage protection on every order. If your product arrives damaged in transit, contact us with photos for a one-time replacement. All claims require photo evidence and are subject to review. One replacement per customer per order. Reconstituted products are not eligible. We do not offer refunds for change of mind or misuse.
Are your peptides third-party tested?
Yes, every batch is tested by independent, accredited U.S. laboratories for purity verification and Mass Spectrometry for identity confirmation. Test results are published on each product page as Certificates of Analysis (CoA).
How long does shipping take?
Orders are processed within 1-2 business days. Standard shipping typically arrives within 3-5 business days from fulfillment. Express and overnight options are available at checkout. Every order includes free shipment protection.
Do you ship internationally?
Currently, we ship within the United States only. We're working on expanding our shipping capabilities to serve researchers worldwide.
Can I modify or cancel my order?
Orders can be modified or canceled within 5 min of placement. After this window, orders enter processing and cannot be changed. Contact hello@aurevenaresearch.com immediately if you need to make changes.
What should I do if my item arrives damaged?
We offer damage protection on every order. If your product arrives damaged in transit, contact us with photos for a one-time replacement. All claims require photo evidence and are subject to review. One replacement per customer per order. Reconstituted products are not eligible. We do not offer refunds for change of mind or misuse.
Recently Viewed
Sources & References
Peer-reviewed research
Ann Clin Lab Sci
Anti-Cancer Peptide PNC-27 Kills Cancer Cells by Unique Interactions with Plasma Membrane-Bound HDM-2 and Mitochondrial Membranes
Biomedicines
PNC-27, a Chimeric p53-Penetratin Peptide Binds to HDM-2 in a p53 Peptide-like Structure, Induces Selective Membrane-Pore Formation and Leads to Cancer Cell Lysis
Research FAQ
Compound and research-use information
What is PNC-27?
PNC-27 is a synthetic peptide containing a p53-derived domain linked to a membrane-penetrating sequence. It is provided for laboratory research use.
What is PNC-27 studied for in the research setting?
PNC-27 is studied in vitro in cancer-cell research models for its reported interaction with membrane-associated HDM-2 and effects on cell-membrane integrity. It is used strictly as a research tool in cell-biology investigations.
What form is Aurevena's PNC-27 supplied in?
PNC-27 is supplied as a lyophilized (freeze-dried) powder. Every batch is tested by independent, accredited U.S. laboratories for purity and identity, with the Certificate of Analysis published on this product page. Store lyophilized peptide cold and protected from light, and avoid repeated freeze-thaw cycles.
Is PNC-27 intended for human use?
No. PNC-27 is sold by Aurevena strictly for laboratory and research use only. It is not a drug, dietary supplement, cosmetic, or medical device, and is not intended for human or veterinary use, consumption, or for the diagnosis, treatment, cure, or prevention of any disease.
