
LL37 (5mg)
$57.99
LL-37 is a human cathelicidin antimicrobial peptide studied in innate-immunity and host-defense research models. Lyophilized powder for laboratory research use only.
Fast Fulfillment
Ships with 1-2 business days
Research Guarantee
Damaged on arrival. Replaced
$150 + Free Shipping
Fast & Tracked
U.S. Third-Party Tested
COA available for each product
Independently Verified. Every Batch
Every Aurevena product is sent to an independent, accredited third-party laboratory before it is offered for sale. Certificates of Analysis confirm compound identity, purity percentage, and the absence of harmful contaminants.
COAs are published by lot number so researchers can verify the exact product they receive. We do not sell any product that does not clear our purity threshold.
- Compound identity (HPLC / MS verification)
- Purity percentage (target ≥ 99%)
- Absence of heavy metals
- Lot-number traceability
LL37 (5mg)
5mg
- Description
- Compound Info
- Research Overview
Description
LL-37 is the only human cathelicidin-derived antimicrobial peptide and a widely used tool compound in innate-immunity research. Laboratory investigators study LL-37 for its membrane-interacting antimicrobial activity, immunomodulatory signaling, chemotactic effects on immune cells, and its role in host-defense and wound-environment models in vitro and in preclinical systems. It is examined for interactions with bacterial membranes, biofilm models, and Toll-like receptor signaling. Supplied for in-vitro and laboratory research only — not for human or veterinary use.
| Compound Class | Synthetic 37-amino acid cathelicidin-derived antimicrobial peptide (human cathelicidin LL-37) |
|---|---|
| CAS Number | 154947-66-7 |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | Approximately 4493.33 g/mol |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
| Appearance | White to off-white lyophilized powder |
Research Overview
Storage
IMPORTANT RESEARCH NOTICE
Not for human consumption.
This product is sold exclusively for research and educational purposes. It is not intended to diagnose, treat, cure, or prevent any disease. All clinical trial data and research findings presented on this page are sourced from peer-reviewed journals and official publications. They are provided for educational reference only and should not be interpreted as medical advice or product claims. By purchasing this product, you confirm that you are a qualified researcher and will use it in accordance with all applicable laws and regulations.
Frequently Asked Questions
How should I store my peptides?
What is your return policy?
Are your peptides third-party tested?
How long does shipping take?
Do you ship internationally?
Can I modify or cancel my order?
What should I do if my item arrives damaged?
Recently Viewed
Molecular Specification
| Compound type | Cathelicidin antimicrobial peptide |
|---|---|
| Amino-acid length | 37 |
| Sequence | [LL-37, 37 aa] |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493.4 Da (avg) |
| CAS number | 597562-32-8 |
| Physical form | Lyophilized powder (typically acetate salt) |
| Verification | Third-party HPLC tested; Certificate of Analysis included |
Reference data for research use only. Confirm identity and purity against the batch Certificate of Analysis.
Sources & References
Peer-reviewed research
LL-37: Cathelicidin-related antimicrobial peptide with pleiotropic activity
Upregulating Human Cathelicidin Antimicrobial Peptide LL-37 Expression May Prevent Severe COVID-19 Inflammatory Responses and Reduce Microthrombosis
Research FAQ
Compound and research-use information
What is LL-37?
LL-37 is the naturally occurring human cathelicidin antimicrobial peptide (37 residues). It is supplied for laboratory research use.
What is LL-37 studied for in the research setting?
LL-37 is studied in vitro and in preclinical models for research into host-defense (antimicrobial) activity, immune modulation, and membrane interactions. It is used as a reference antimicrobial peptide in immunology and microbiology research.
What form is Aurevena's LL-37 supplied in?
LL-37 is supplied as a lyophilized (freeze-dried) powder. Every batch is tested by independent, accredited U.S. laboratories for purity and identity, with the Certificate of Analysis published on this product page. Store lyophilized peptide cold and protected from light, and avoid repeated freeze-thaw cycles.
Is LL-37 intended for human use?
No. LL-37 is sold by Aurevena strictly for laboratory and research use only. It is not a drug, dietary supplement, cosmetic, or medical device, and is not intended for human or veterinary use, consumption, or for the diagnosis, treatment, cure, or prevention of any disease.




