Molecular Specification
| Compound type | Cathelicidin antimicrobial peptide |
|---|---|
| Amino-acid length | 37 |
| Sequence | [LL-37, 37 aa] |
| Molecular formula | C205H340N60O53 |
| Molecular weight | 4493.4 Da (avg) |
| CAS number | 597562-32-8 |
| Physical form | Lyophilized powder (typically acetate salt) |
| Verification | Third-party HPLC tested; Certificate of Analysis included |
Reference data for research use only. Confirm identity and purity against the batch Certificate of Analysis.
Sources & References
Peer-reviewed research
LL-37: Cathelicidin-related antimicrobial peptide with pleiotropic activity
Upregulating Human Cathelicidin Antimicrobial Peptide LL-37 Expression May Prevent Severe COVID-19 Inflammatory Responses and Reduce Microthrombosis
Research FAQ
Compound and research-use information
What is LL-37?
LL-37 is the naturally occurring human cathelicidin antimicrobial peptide (37 residues). It is supplied for laboratory research use.
What is LL-37 studied for in the research setting?
LL-37 is studied in vitro and in preclinical models for research into host-defense (antimicrobial) activity, immune modulation, and membrane interactions. It is used as a reference antimicrobial peptide in immunology and microbiology research.
What form is Aurevena's LL-37 supplied in?
LL-37 is supplied as a lyophilized (freeze-dried) powder. Every batch is tested by independent, accredited U.S. laboratories for purity and identity, with the Certificate of Analysis published on this product page. Store lyophilized peptide cold and protected from light, and avoid repeated freeze-thaw cycles.
Is LL-37 intended for human use?
No. LL-37 is sold by Aurevena strictly for laboratory and research use only. It is not a drug, dietary supplement, cosmetic, or medical device, and is not intended for human or veterinary use, consumption, or for the diagnosis, treatment, cure, or prevention of any disease.






