
VIP10 (10mg)
$179.99
VIP (10-28) is a vasoactive intestinal peptide fragment studied in VPAC-receptor and neuro-immune signaling research models. Lyophilized powder for laboratory use only.
Fast Fulfillment
Ships with 1-2 business days
Research Guarantee
Damaged on arrival. Replaced
$150 + Free Shipping
Fast & Tracked
U.S. Third-Party Tested
COA available for each product
Independently Verified. Every Batch
Every Aurevena product is sent to an independent, accredited third-party laboratory before it is offered for sale. Certificates of Analysis confirm compound identity, purity percentage, and the absence of harmful contaminants.
COAs are published by lot number so researchers can verify the exact product they receive. We do not sell any product that does not clear our purity threshold.
- Compound identity (HPLC / MS verification)
- Purity percentage (target ≥ 99%)
- Absence of heavy metals
- Lot-number traceability
VIP10 (10mg)
10mg
- Description
- Compound Info
- Research Overview
Description
VIP (10-28) is a fragment of vasoactive intestinal peptide (VIP), a neuropeptide with broad signaling roles, used as a tool compound in neuro-immune and receptor research. Laboratory investigators study VIP-related peptides for their interactions with the VPAC1 and VPAC2 receptors, cAMP signaling, and roles in vasodilation, immune-modulation, and neuroendocrine pathways in vitro and in preclinical systems. Supplied for in-vitro and laboratory research only — not for human or veterinary use.
| Compound Class | Synthetic peptide fragment (Vasoactive Intestinal Peptide-derived 10-amino acid fragment, or full VIP at lower scale; verify specific form with supplier) |
|---|---|
| CAS Number | 37221-79-7 (full-length VIP) |
| Molecular Formula | Variable depending on specific fragment supplied |
| Molecular Weight | Variable; full-length VIP is approximately 3326 g/mol |
| Sequence | Sequence-dependent on specific product form |
| Appearance | White to off-white lyophilized powder |
Research Overview
Storage
IMPORTANT RESEARCH NOTICE
Not for human consumption.
This product is sold exclusively for research and educational purposes. It is not intended to diagnose, treat, cure, or prevent any disease. All clinical trial data and research findings presented on this page are sourced from peer-reviewed journals and official publications. They are provided for educational reference only and should not be interpreted as medical advice or product claims. By purchasing this product, you confirm that you are a qualified researcher and will use it in accordance with all applicable laws and regulations.
Frequently Asked Questions
How should I store my peptides?
What is your return policy?
Are your peptides third-party tested?
How long does shipping take?
Do you ship internationally?
Can I modify or cancel my order?
What should I do if my item arrives damaged?
Recently Viewed
Molecular Specification
| Compound type | Vasoactive intestinal peptide (aviptadil, amidated) |
|---|---|
| Amino-acid length | 28 |
| Sequence | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Molecular formula | C147H238N44O42S |
| Molecular weight | 3325.8 Da (avg) |
| CAS number | 40077-57-4 |
| Physical form | Lyophilized powder (typically acetate salt) |
| Verification | Third-party HPLC tested; Certificate of Analysis included |
Reference data for research use only. Confirm identity and purity against the batch Certificate of Analysis.
Sources & References
Peer-reviewed research
Skin neurogenic inflammation (role of vasoactive intestinal peptide / VIP and other neuropeptides)
Vasoactive intestinal peptide/pituitary adenylate cyclase activating polypeptide, and their receptors and cancer
Pituitary adenylate cyclase-activating polypeptide/vasoactive intestinal peptide [Part 1]: biology, pharmacology, and new insights into their cellular basis of action/signaling which are providing new therapeutic targets
Research FAQ
Compound and research-use information
What is VIP (Vasoactive Intestinal Peptide)?
VIP is a naturally occurring 28-amino-acid neuropeptide (vasoactive intestinal peptide). Aurevena supplies it as a research chemical for laboratory study.
What is VIP (Vasoactive Intestinal Peptide) studied for in the research setting?
VIP is studied in vitro and in preclinical models for its role in VPAC-receptor signaling, immune modulation, and neuroendocrine pathways. It is used as a reference neuropeptide in mechanistic research.
What form is Aurevena's VIP (Vasoactive Intestinal Peptide) supplied in?
VIP (Vasoactive Intestinal Peptide) is supplied as a lyophilized (freeze-dried) powder. Every batch is tested by independent, accredited U.S. laboratories for purity and identity, with the Certificate of Analysis published on this product page. Store lyophilized peptide cold and protected from light, and avoid repeated freeze-thaw cycles.
Is VIP (Vasoactive Intestinal Peptide) intended for human use?
No. VIP (Vasoactive Intestinal Peptide) is sold by Aurevena strictly for laboratory and research use only. It is not a drug, dietary supplement, cosmetic, or medical device, and is not intended for human or veterinary use, consumption, or for the diagnosis, treatment, cure, or prevention of any disease.



