Free Shipping Over $150+
IGF-1LR3 (1mg)
$79.99
IGF-1 LR3 is a long-acting insulin-like growth factor-1 analog studied in IGF-receptor and cell-growth research models. Lyophilized powder for laboratory use only.
We Accept:
Certificate of Analysis
DOWNLOAD
Independently Verified. Every Batch
Every Aurevena product is sent to an independent, accredited third-party laboratory before it is offered for sale. Certificates of Analysis confirm compound identity, purity percentage, and the absence of harmful contaminants.
COAs are published by lot number so researchers can verify the exact product they receive. We do not sell any product that does not clear our purity threshold.
- Compound identity (HPLC / MS verification)
- Purity percentage (target ≥ 99%)
- Absence of heavy metals
- Lot-number traceability
CERTIFICATE OF ANALYSIS
IGF-1LR3 (1mg)
1mg
PURITY
99.00%%
ASSAY
1.11mg
IDENTITY
Confirmed
HEAVY METALS
<10 ppb
TAMC
0 CFU
TYMC
0 CFU
BATCH/LOT
20260112L01IGFS01
- Description
- Compound Info
- Research Overview
Description
IGF-1 LR3 (Long R3 IGF-1) is an engineered analog of insulin-like growth factor-1 with an arginine substitution and an N-terminal extension that reduce binding to IGF-binding proteins, extending its activity. It is a widely used tool compound in cell-growth and signaling research. Supplied for in-vitro and laboratory research only — not for human or veterinary use.
| Compound Class | Recombinant 83-amino acid IGF-1 analog (Long R3 IGF-1) |
|---|---|
| CAS Number | 946870-92-4 |
| Molecular Formula | C400H625N111O115S9 (approximate) |
| Molecular Weight | Approximately 9117.5 g/mol |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA (Arg at position 3; 13-residue N-terminal extension) |
| Appearance | White to off-white lyophilized powder |
Research Overview
Used in in vitro and preclinical research relating to IGF-1 receptor chemistry and growth-factor signaling studies.
Storage
Store unreconstituted vials refrigerated at 2-8°C and long-term at -20°C; once reconstituted, store at 2-8°C and use within 30 days.
IMPORTANT RESEARCH NOTICE
Not for human consumption.
This product is sold exclusively for research and educational purposes. It is not intended to diagnose, treat, cure, or prevent any disease. All clinical trial data and research findings presented on this page are sourced from peer-reviewed journals and official publications. They are provided for educational reference only and should not be interpreted as medical advice or product claims. By purchasing this product, you confirm that you are a qualified researcher and will use it in accordance with all applicable laws and regulations.
Frequently Asked Questions
How should I store my peptides?
Lyophilized (powder) peptides should be stored at -20°C for long-term storage or 2-8°C (refrigerator) for short-term. Always protect from light and avoid repeated freeze-thaw cycles.
What is your return policy?
We offer damage protection on every order. If your product arrives damaged in transit, contact us with photos for a one-time replacement. All claims require photo evidence and are subject to review. One replacement per customer per order. Reconstituted products are not eligible. We do not offer refunds for change of mind or misuse.
Are your peptides third-party tested?
Yes, every batch is tested by independent, accredited U.S. laboratories for purity verification and Mass Spectrometry for identity confirmation. Test results are published on each product page as Certificates of Analysis (CoA).
How long does shipping take?
Orders are processed within 1-2 business days. Standard shipping typically arrives within 3-5 business days from fulfillment. Express and overnight options are available at checkout. Every order includes free shipment protection.
Do you ship internationally?
Currently, we ship within the United States only. We're working on expanding our shipping capabilities to serve researchers worldwide.
Can I modify or cancel my order?
Orders can be modified or canceled within 5 min of placement. After this window, orders enter processing and cannot be changed. Contact hello@aurevenaresearch.com immediately if you need to make changes.
What should I do if my item arrives damaged?
We offer damage protection on every order. If your product arrives damaged in transit, contact us with photos for a one-time replacement. All claims require photo evidence and are subject to review. One replacement per customer per order. Reconstituted products are not eligible. We do not offer refunds for change of mind or misuse.
Recently Viewed
Sources & References
Peer-reviewed research
Endocrine
Involvement of IGF-1 and its binding proteins in proliferation and differentiation of murine macrophage precursors (uses Long-R3-IGF-1)
Appl Microbiol Biotechnol
Recombinant expression of IGF-1 and LR3 IGF-1 fused with xylanase in Pichia pastoris
Research FAQ
Compound and research-use information
What is IGF-1 LR3?
IGF-1 LR3 (Long R3 IGF-1) is a synthetic 83-amino-acid analog of insulin-like growth factor 1 modified for reduced binding to IGF-binding proteins. It is supplied strictly for laboratory research use.
What is IGF-1 LR3 studied for in the research setting?
IGF-1 LR3 is widely used in vitro as a cell-culture reagent and reference ligand to study IGF-1-receptor signaling, cell proliferation, and growth-factor pathways in laboratory models. It is a research reagent only.
What form is Aurevena's IGF-1 LR3 supplied in?
IGF-1 LR3 is supplied as a lyophilized (freeze-dried) powder. Every batch is tested by independent, accredited U.S. laboratories for purity and identity, with the Certificate of Analysis published on this product page. Store lyophilized peptide cold and protected from light, and avoid repeated freeze-thaw cycles.
Is IGF-1 LR3 intended for human use?
No. IGF-1 LR3 is sold by Aurevena strictly for laboratory and research use only. It is not a drug, dietary supplement, cosmetic, or medical device, and is not intended for human or veterinary use, consumption, or for the diagnosis, treatment, cure, or prevention of any disease.
